Recombinant Human C2orf88 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C2orf88-6551H
Product Overview : C2orf88 MS Standard C13 and N15-labeled recombinant protein (NP_001035985) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C2orf88 (Chromosome 2 Open Reading Frame 88) is a Protein Coding gene. Diseases associated with C2orf88 include Myostatin-Related Muscle Hypertrophy. Gene Ontology (GO) annotations related to this gene include protein kinase A regulatory subunit binding.
Molecular Mass : 11 kDa
AA Sequence : MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNIVILEYAHRLSQDILCDALQQWACNNIKYHDIPYIESEGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C2orf88 chromosome 2 open reading frame 88 [ Homo sapiens (human) ]
Official Symbol C2orf88
Synonyms C2orf88; chromosome 2 open reading frame 88; small membrane A-kinase anchor protein; small A-kinase anchoring protein; small membrane AKAP
Gene ID 84281
mRNA Refseq NM_001042520
Protein Refseq NP_001035985
MIM 615117
UniProt ID Q9BSF0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C2orf88 Products

Required fields are marked with *

My Review for All C2orf88 Products

Required fields are marked with *

0
cart-icon
0
compare icon