Recombinant Human C3orf33 Protein, GST-Tagged

• Cat.No.: C3orf33-0026H
• Product Overview: Human C3orf33 full-length ORF (BAB70989.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C3orf33 (Chromosome 3 Open Reading Frame 33) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and hydrolase activity, acting on ester bonds.
• Molecular Mass: 55.7 kDa
• AA Sequence: MAIAGIMLLLRSIRLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHRNLLKAELTALKKGEGIWKEDSEKESYLEKFKDSWREIWKKDSFLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILKFRELISRINFRRKG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C3orf33 chromosome 3 open reading frame 33 [ Homo sapiens ]
• Official Symbol: C3orf33
• Synonyms: C3ORF33; chromosome 3 open reading frame 33; uncharacterized protein C3orf33; AC3 33; FLJ31139; AP-1 activity suppressor; AC3-33
• Gene ID: 285315
• mRNA Refseq: NM_173657
• Protein Refseq: NP_775928
• UniProt ID: Q6P1S2