Recombinant Human C3orf33 Protein, GST-Tagged
Cat.No. : | C3orf33-0026H |
Product Overview : | Human C3orf33 full-length ORF (BAB70989.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C3orf33 (Chromosome 3 Open Reading Frame 33) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and hydrolase activity, acting on ester bonds. |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MAIAGIMLLLRSIRLTSKFTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGVELAETGKAWLQKELKPSQLLWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHRNLLKAELTALKKGEGIWKEDSEKESYLEKFKDSWREIWKKDSFLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILKFRELISRINFRRKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C3orf33 chromosome 3 open reading frame 33 [ Homo sapiens ] |
Official Symbol | C3orf33 |
Synonyms | C3ORF33; chromosome 3 open reading frame 33; uncharacterized protein C3orf33; AC3 33; FLJ31139; AP-1 activity suppressor; AC3-33; |
Gene ID | 285315 |
mRNA Refseq | NM_173657 |
Protein Refseq | NP_775928 |
UniProt ID | Q6P1S2 |
◆ Recombinant Proteins | ||
RFL7119HF | Recombinant Full Length Human Uncharacterized Protein C3Orf33(C3Orf33) Protein, His-Tagged | +Inquiry |
C3orf33-2591HF | Recombinant Full Length Human C3orf33 Protein, GST-tagged | +Inquiry |
C3orf33-0026H | Recombinant Human C3orf33 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C3orf33 Products
Required fields are marked with *
My Review for All C3orf33 Products
Required fields are marked with *
0
Inquiry Basket