Recombinant Human C3orf56 Protein, GST-Tagged
| Cat.No. : | C3orf56-0040H |
| Product Overview : | Human C3orf56 full-length ORF (NP_001007535.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | C3orf56 (Chromosome 3 Open Reading Frame 56) is a Protein Coding gene. |
| Molecular Mass : | 52.4 kDa |
| AA Sequence : | MGTGASEKQAEQKVRRAFEASEEAHGTLAASTPWVAMGSAYGSCTCLGAQPVTDLALWPVIYSCMGFSPQAYPAFWAYPWVLYGGYLWMGYPPPAALVPSVWLYWRGASSFDPLIGSPYLAALAPNLFPFPMKFPPTYSLASPTLGGATSSHCPQVGCWTPASSAPRAAVEGPSRGAPYLKTCKAPPSEWASRFGIWAPLPCCSSELRPLPPSPIEDSQLDPGCSRSSSRSPCRARRRLFEC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C3orf56 chromosome 3 open reading frame 56 [ Homo sapiens (human) ] |
| Official Symbol | C3orf56 |
| Synonyms | C3orf56; chromosome 3 open reading frame 56; putative uncharacterized protein C3orf56; Chromosome 3 Open Reading Frame 56 |
| Gene ID | 285311 |
| mRNA Refseq | NM_001007534 |
| Protein Refseq | NP_001007535 |
| UniProt ID | Q8N813 |
| ◆ Recombinant Proteins | ||
| C3orf56-0040H | Recombinant Human C3orf56 Protein, GST-Tagged | +Inquiry |
| C3orf56-2601HF | Recombinant Full Length Human C3orf56 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C3orf56 Products
Required fields are marked with *
My Review for All C3orf56 Products
Required fields are marked with *
