Recombinant Human C3orf56 Protein, GST-Tagged

Cat.No. : C3orf56-0040H
Product Overview : Human C3orf56 full-length ORF (NP_001007535.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C3orf56 (Chromosome 3 Open Reading Frame 56) is a Protein Coding gene.
Molecular Mass : 52.4 kDa
AA Sequence : MGTGASEKQAEQKVRRAFEASEEAHGTLAASTPWVAMGSAYGSCTCLGAQPVTDLALWPVIYSCMGFSPQAYPAFWAYPWVLYGGYLWMGYPPPAALVPSVWLYWRGASSFDPLIGSPYLAALAPNLFPFPMKFPPTYSLASPTLGGATSSHCPQVGCWTPASSAPRAAVEGPSRGAPYLKTCKAPPSEWASRFGIWAPLPCCSSELRPLPPSPIEDSQLDPGCSRSSSRSPCRARRRLFEC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C3orf56 chromosome 3 open reading frame 56 [ Homo sapiens (human) ]
Official Symbol C3orf56
Synonyms C3orf56; chromosome 3 open reading frame 56; putative uncharacterized protein C3orf56; Chromosome 3 Open Reading Frame 56
Gene ID 285311
mRNA Refseq NM_001007534
Protein Refseq NP_001007535
UniProt ID Q8N813

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C3orf56 Products

Required fields are marked with *

My Review for All C3orf56 Products

Required fields are marked with *

0
cart-icon
0
compare icon