Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: C4orf3-129H
• Product Overview: C4orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001001701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C4orf3 (Chromosome 4 Open Reading Frame 3) is a Protein Coding gene. Diseases associated with C4orf3 include Hepatitis C Virus.
• Molecular Mass: 7.6 kDa
• AA Sequence: MEVDAPGVDGRDGLREQRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C4orf3 chromosome 4 open reading frame 3 [ Homo sapiens (human) ]
• Official Symbol: C4orf3
• Synonyms: C4orf3; chromosome 4 open reading frame 3; ALN; HCVFTP1; uncharacterized protein C4orf3; HCV F-transactivated protein 1; another-regulin; hepatitis C virus F protein-transactivated protein 1
• Gene ID: 401152
• mRNA Refseq: NM_001001701
• Protein Refseq: NP_001001701
• UniProt ID: Q8WVX3