Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | C4orf3-129H |
Product Overview : | C4orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001001701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C4orf3 (Chromosome 4 Open Reading Frame 3) is a Protein Coding gene. Diseases associated with C4orf3 include Hepatitis C Virus. |
Molecular Mass : | 7.6 kDa |
AA Sequence : | MEVDAPGVDGRDGLREQRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C4orf3 chromosome 4 open reading frame 3 [ Homo sapiens (human) ] |
Official Symbol | C4orf3 |
Synonyms | C4orf3; chromosome 4 open reading frame 3; ALN; HCVFTP1; uncharacterized protein C4orf3; HCV F-transactivated protein 1; another-regulin; hepatitis C virus F protein-transactivated protein 1 |
Gene ID | 401152 |
mRNA Refseq | NM_001001701 |
Protein Refseq | NP_001001701 |
UniProt ID | Q8WVX3 |
◆ Recombinant Proteins | ||
C4orf3-1869H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged | +Inquiry |
RFL21474HF | Recombinant Full Length Human Uncharacterized Protein C4Orf3(C4Orf3) Protein, His-Tagged | +Inquiry |
C4orf3-129H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
C4ORF3-1071H | Recombinant Human C4ORF3 Protein (1-44 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4orf3 Products
Required fields are marked with *
My Review for All C4orf3 Products
Required fields are marked with *