Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : C4orf3-129H
Product Overview : C4orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001001701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C4orf3 (Chromosome 4 Open Reading Frame 3) is a Protein Coding gene. Diseases associated with C4orf3 include Hepatitis C Virus.
Molecular Mass : 7.6 kDa
AA Sequence : MEVDAPGVDGRDGLREQRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C4orf3 chromosome 4 open reading frame 3 [ Homo sapiens (human) ]
Official Symbol C4orf3
Synonyms C4orf3; chromosome 4 open reading frame 3; ALN; HCVFTP1; uncharacterized protein C4orf3; HCV F-transactivated protein 1; another-regulin; hepatitis C virus F protein-transactivated protein 1
Gene ID 401152
mRNA Refseq NM_001001701
Protein Refseq NP_001001701
UniProt ID Q8WVX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4orf3 Products

Required fields are marked with *

My Review for All C4orf3 Products

Required fields are marked with *

0
cart-icon