Recombinant Human C5orf24 Protein, GST-Tagged
Cat.No. : | C5orf24-0084H |
Product Overview : | Human C5orf24 full-length ORF (NP_689622.2, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C5orf24 (Chromosome 5 Open Reading Frame 24) is a Protein Coding gene. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C5orf24 chromosome 5 open reading frame 24 [ Homo sapiens ] |
Official Symbol | C5orf24 |
Synonyms | C5ORF24; chromosome 5 open reading frame 24; UPF0461 protein C5orf24; FLJ37562; |
Gene ID | 134553 |
mRNA Refseq | NM_001135586 |
Protein Refseq | NP_001129058 |
UniProt ID | Q7Z6I8 |
◆ Recombinant Proteins | ||
C5orf24-5348H | Recombinant Human C5orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C5orf24-574H | Recombinant Human C5orf24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C5orf24-0084H | Recombinant Human C5orf24 Protein, GST-Tagged | +Inquiry |
C5orf24-2664HF | Recombinant Full Length Human C5orf24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5orf24-8017HCL | Recombinant Human C5orf24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C5orf24 Products
Required fields are marked with *
My Review for All C5orf24 Products
Required fields are marked with *
0
Inquiry Basket