Recombinant Human C6orf106 Protein, GST-Tagged
| Cat.No. : | C6orf106-0099H |
| Product Overview : | Human C6orf106 full-length ORF (NP_077270.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | C6orf106 (Chromosome 6 Open Reading Frame 106) is a Protein Coding gene. GO annotations related to this gene include ubiquitin binding. |
| Molecular Mass : | 59.3 kDa |
| AA Sequence : | MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C6orf106 chromosome 6 open reading frame 106 [ Homo sapiens ] |
| Official Symbol | C6orf106 |
| Synonyms | FP852; dJ391O22.4; RP3-391O22.4 |
| Gene ID | 64771 |
| mRNA Refseq | NM_024294 |
| Protein Refseq | NP_077270 |
| MIM | 612217 |
| UniProt ID | Q9H6K1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C6orf106 Products
Required fields are marked with *
My Review for All C6orf106 Products
Required fields are marked with *



