Recombinant Human C6orf106 Protein, GST-Tagged

Cat.No. : C6orf106-0099H
Product Overview : Human C6orf106 full-length ORF (NP_077270.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C6orf106 (Chromosome 6 Open Reading Frame 106) is a Protein Coding gene. GO annotations related to this gene include ubiquitin binding.
Molecular Mass : 59.3 kDa
AA Sequence : MEGMDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYYDFESPNISVPSMSFVEDVTIGEGESIPPDTQFVKTWRIQNSGAEAWPPGVCLKYVGGDQFGHVNMVMVRSLEPQEIADVSVQMCSPSRAGMYQGQWRMCTATGLYYGDVIWVILSVEVGGLLGVTQQLSSFETEFNTQPHRKVEGNFNPFASPQKNRQSDENNLKDPGGSEFDSISKNTWAPAPDTWAPAPDQTEQDQNRLSQNSVNLSPSSHANNLSVVTYSKGLHGPYPFGQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C6orf106 chromosome 6 open reading frame 106 [ Homo sapiens ]
Official Symbol C6orf106
Synonyms FP852; dJ391O22.4; RP3-391O22.4
Gene ID 64771
mRNA Refseq NM_024294
Protein Refseq NP_077270
MIM 612217
UniProt ID Q9H6K1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C6orf106 Products

Required fields are marked with *

My Review for All C6orf106 Products

Required fields are marked with *

0
cart-icon
0
compare icon