Recombinant Human C6orf226 Protein, GST-tagged

Cat.No. : C6orf226-4783H
Product Overview : Human LOC441150 full-length ORF (NP_001008739.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C6orf226 (Chromosome 6 Open Reading Frame 226) is a Protein Coding gene.
Molecular Mass : 37.51 kDa
AA Sequence : MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C6orf226 chromosome 6 open reading frame 226 [ Homo sapiens (human) ]
Official Symbol C6orf226
Synonyms C6orf226; chromosome 6 open reading frame 226; uncharacterized protein C6orf226
Gene ID 441150
mRNA Refseq NM_001008739
Protein Refseq NP_001008739
UniProt ID Q5I0X4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C6orf226 Products

Required fields are marked with *

My Review for All C6orf226 Products

Required fields are marked with *

0
cart-icon