Recombinant Human C6orf226 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C6orf226-1801H
Product Overview : C6orf226 MS Standard C13 and N15-labeled recombinant protein (NP_001008739) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C6orf226 (Chromosome 6 Open Reading Frame 226) is a Protein Coding gene.
Molecular Mass : 10.6 kDa
AA Sequence : MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C6orf226 chromosome 6 open reading frame 226 [ Homo sapiens (human) ]
Official Symbol C6orf226
Synonyms C6orf226; chromosome 6 open reading frame 226; uncharacterized protein C6orf226
Gene ID 441150
mRNA Refseq NM_001008739
Protein Refseq NP_001008739
UniProt ID Q5I0X4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C6orf226 Products

Required fields are marked with *

My Review for All C6orf226 Products

Required fields are marked with *

0
cart-icon