Recombinant Human C6orf226 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C6orf226-1801H |
| Product Overview : | C6orf226 MS Standard C13 and N15-labeled recombinant protein (NP_001008739) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | C6orf226 (Chromosome 6 Open Reading Frame 226) is a Protein Coding gene. |
| Molecular Mass : | 10.6 kDa |
| AA Sequence : | MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C6orf226 chromosome 6 open reading frame 226 [ Homo sapiens (human) ] |
| Official Symbol | C6orf226 |
| Synonyms | C6orf226; chromosome 6 open reading frame 226; uncharacterized protein C6orf226 |
| Gene ID | 441150 |
| mRNA Refseq | NM_001008739 |
| Protein Refseq | NP_001008739 |
| UniProt ID | Q5I0X4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C6orf226 Products
Required fields are marked with *
My Review for All C6orf226 Products
Required fields are marked with *
