Recombinant Human C6orf226 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | C6orf226-1801H |
Product Overview : | C6orf226 MS Standard C13 and N15-labeled recombinant protein (NP_001008739) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | C6orf226 (Chromosome 6 Open Reading Frame 226) is a Protein Coding gene. |
Molecular Mass : | 10.6 kDa |
AA Sequence : | MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | C6orf226 chromosome 6 open reading frame 226 [ Homo sapiens (human) ] |
Official Symbol | C6orf226 |
Synonyms | C6orf226; chromosome 6 open reading frame 226; uncharacterized protein C6orf226 |
Gene ID | 441150 |
mRNA Refseq | NM_001008739 |
Protein Refseq | NP_001008739 |
UniProt ID | Q5I0X4 |
◆ Recombinant Proteins | ||
C6orf226-1801H | Recombinant Human C6orf226 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C6orf226-4783H | Recombinant Human C6orf226 Protein, GST-tagged | +Inquiry |
C6orf226-5885HF | Recombinant Full Length Human C6orf226 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C6orf226-7984HCL | Recombinant Human C6orf226 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C6orf226 Products
Required fields are marked with *
My Review for All C6orf226 Products
Required fields are marked with *
0
Inquiry Basket