Recombinant Human C7orf34 Protein, GST-Tagged
Cat.No. : | C7orf34-0143H |
Product Overview : | Human C7orf34 full-length ORF (AAH14596.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | C7orf34 (Chromosome 7 Open Reading Frame 34) is a Protein Coding gene. |
Molecular Mass : | 39.82 kDa |
AA Sequence : | MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEEDQSSKTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFMLTH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C7orf34 chromosome 7 open reading frame 34 [ Homo sapiens ] |
Official Symbol | C7orf34 |
Synonyms | ctm-1 |
Gene ID | 135927 |
mRNA Refseq | NM_178829 |
Protein Refseq | NP_849151 |
UniProt ID | Q96L11 |
◆ Recombinant Proteins | ||
C7orf34-2623HF | Recombinant Full Length Human C7orf34 Protein, GST-tagged | +Inquiry |
C7orf34-0143H | Recombinant Human C7orf34 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C7orf34-128HCL | Recombinant Human C7orf34 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C7orf34 Products
Required fields are marked with *
My Review for All C7orf34 Products
Required fields are marked with *
0
Inquiry Basket