Recombinant Human C7orf34 Protein, GST-Tagged

• Cat.No.: C7orf34-0143H
• Product Overview: Human C7orf34 full-length ORF (AAH14596.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C7orf34 (Chromosome 7 Open Reading Frame 34) is a Protein Coding gene.
• Molecular Mass: 39.82 kDa
• AA Sequence: MPPLAPQLCRAVFLVPILLLLQVKPLNGSPGPKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEEDQSSKTAAVHKHSFHLSFCFSLASVMVFSGGPLRRTFPNIQLCFMLTH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C7orf34 chromosome 7 open reading frame 34 [ Homo sapiens ]
• Official Symbol: C7orf34
• Synonyms: ctm-1
• Gene ID: 135927
• mRNA Refseq: NM_178829
• Protein Refseq: NP_849151
• UniProt ID: Q96L11