Recombinant Human C7orf61 Protein, GST-Tagged

Cat.No. : C7orf61-0153H
Product Overview : Human C7orf61 full-length ORF (NP_001004323.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : C7orf61 (Chromosome 7 Open Reading Frame 61) is a Protein Coding gene.
Molecular Mass : 50.3 kDa
AA Sequence : MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLVELPKEAKPKLGESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQSGWQMCSWKSSVSSASVSSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C7orf61 chromosome 7 open reading frame 61 [ Homo sapiens ]
Official Symbol C7orf61
Synonyms C7ORF61; chromosome 7 open reading frame 61; uncharacterized protein C7orf61; IMAGE:4839025;
Gene ID 402573
mRNA Refseq NM_001004323
Protein Refseq NP_001004323
UniProt ID Q8IZ16

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C7orf61 Products

Required fields are marked with *

My Review for All C7orf61 Products

Required fields are marked with *

0
cart-icon
0
compare icon