Recombinant Full Length Human C7orf61 Protein, GST-tagged

• Cat.No.: C7orf61-2632HF
• Product Overview: Human C7orf61 full-length ORF (NP_001004323.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 206 amino acids
• Description: C7orf61 (Chromosome 7 Open Reading Frame 61) is a Protein Coding gene.
• Molecular Mass: 50.3 kDa
• AA Sequence: MVVVMKFFRWVRRAWQRIISWVFFWRQKIKPTISGHPDSKKHSLKKMEKTLQVVETLRLVELPKEAKPKLGESPELADPCVLAKTTEETEVELGQQGQSLLQLPRTAVKSVSTLMVSALQSGWQMCSWKSSVSSASVSSQVRTQSPLKTPEAELLWEVYLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C7orf61 chromosome 7 open reading frame 61 [ Homo sapiens ]
• Official Symbol: C7orf61
• Synonyms: C7ORF61; chromosome 7 open reading frame 61; uncharacterized protein C7orf61; IMAGE:4839025
• Gene ID: 402573
• mRNA Refseq: NM_001004323
• Protein Refseq: NP_001004323
• MIM: 619782
• UniProt ID: Q8IZ16