Recombinant Human C9orf169 Protein, GST-tagged

• Cat.No.: C9orf169-5297H
• Product Overview: Human MGC59937 full-length ORF ( NP_945352.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CYSRT1 (Cysteine Rich Tail 1) is a Protein Coding gene.
• Molecular Mass: 41.7 kDa
• AA Sequence: MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C9orf169 chromosome 9 open reading frame 169 [ Homo sapiens ]
• Official Symbol: C9orf169
• Synonyms: C9orf169; chromosome 9 open reading frame 169
• Gene ID: 375791
• mRNA Refseq: NM_199001
• Protein Refseq: NP_945352
• UniProt ID: A8MQ03