Recombinant Human C9orf169 Protein, GST-tagged
| Cat.No. : | C9orf169-5297H |
| Product Overview : | Human MGC59937 full-length ORF ( NP_945352.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CYSRT1 (Cysteine Rich Tail 1) is a Protein Coding gene. |
| Molecular Mass : | 41.7 kDa |
| AA Sequence : | MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPVGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C9orf169 chromosome 9 open reading frame 169 [ Homo sapiens ] |
| Official Symbol | C9orf169 |
| Synonyms | C9orf169; chromosome 9 open reading frame 169 |
| Gene ID | 375791 |
| mRNA Refseq | NM_199001 |
| Protein Refseq | NP_945352 |
| UniProt ID | A8MQ03 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf169 Products
Required fields are marked with *
My Review for All C9orf169 Products
Required fields are marked with *
