Recombinant Human C9orf85 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C9orf85-743H
• Product Overview: C9orf85 MS Standard C13 and N15-labeled recombinant protein (NP_872311) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C9orf85 (Chromosome 9 Open Reading Frame 85) is a Protein Coding gene.
• Molecular Mass: 18.3 kDa
• AA Sequence: MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKKEDIVIPLNKETEKIEHTENNLSSNHRRSCRRNEESDDDLDFDIDLEDTGGDHQMNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C9orf85 chromosome 9 open reading frame 85 [ Homo sapiens (human) ]
• Official Symbol: C9orf85
• Synonyms: C9orf85; chromosome 9 open reading frame 85; uncharacterized protein C9orf85
• Gene ID: 138241
• mRNA Refseq: NM_182505
• Protein Refseq: NP_872311
• UniProt ID: Q96MD7