Recombinant Human CA13 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CA13-1316H
Product Overview : CA13 MS Standard C13 and N15-labeled recombinant protein (NP_940986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family.
Molecular Mass : 29.4 kDa
AA Sequence : MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CA13 carbonic anhydrase XIII [ Homo sapiens (human) ]
Official Symbol CA13
Synonyms CA13; carbonic anhydrase XIII; carbonic anhydrase 13; CAXIII; FLJ37995; MGC59868; CA-XIII; carbonate dehydratase XIII; FLJ36434;
Gene ID 377677
mRNA Refseq NM_198584
Protein Refseq NP_940986
MIM 611436
UniProt ID Q8N1Q1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CA13 Products

Required fields are marked with *

My Review for All CA13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon