Recombinant Human CA13 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CA13-1316H |
Product Overview : | CA13 MS Standard C13 and N15-labeled recombinant protein (NP_940986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CA13 carbonic anhydrase XIII [ Homo sapiens (human) ] |
Official Symbol | CA13 |
Synonyms | CA13; carbonic anhydrase XIII; carbonic anhydrase 13; CAXIII; FLJ37995; MGC59868; CA-XIII; carbonate dehydratase XIII; FLJ36434; |
Gene ID | 377677 |
mRNA Refseq | NM_198584 |
Protein Refseq | NP_940986 |
MIM | 611436 |
UniProt ID | Q8N1Q1 |
◆ Recombinant Proteins | ||
CA13-0235H | Recombinant Human CA13 Protein, GST-Tagged | +Inquiry |
Car13-7849M | Recombinant Mouse Car13 protein, His & T7-tagged | +Inquiry |
CA13-1316H | Recombinant Human CA13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CA13-1048H | Recombinant Human CA13 Protein (M1-H262), Tag Free | +Inquiry |
CA13-1049H | Recombinant Human CA13 Protein (M1-H262), His/Strep tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA13 Products
Required fields are marked with *
My Review for All CA13 Products
Required fields are marked with *
0
Inquiry Basket