Recombinant Human CA8 protein, GST-tagged
Cat.No. : | CA8-2618H |
Product Overview : | Recombinant Human CA8 protein(P35219)(1-290aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-290aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60 kDa |
AA Sequence : | MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CA8 carbonic anhydrase VIII [ Homo sapiens ] |
Official Symbol | CA8 |
Synonyms | CA8; carbonic anhydrase VIII; CALS; carbonic anhydrase-related protein; CARP; CA-related protein; carbonate dehydratase; carbonic anhydrase-like sequence; CAMRQ3; CA-VIII; MGC99509; MGC120502; |
Gene ID | 767 |
mRNA Refseq | NM_004056 |
Protein Refseq | NP_004047 |
MIM | 114815 |
UniProt ID | P35219 |
◆ Recombinant Proteins | ||
CAR8-1136R | Recombinant Rat CAR8 Protein | +Inquiry |
Car8-1804M | Active Recombinant Mouse Carbonic Anhydrase 8, His-tagged | +Inquiry |
Car8-749M | Recombinant Mouse Car8 Protein, MYC/DDK-tagged | +Inquiry |
CA8-1683H | Recombinant Human CA8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CA8-2273H | Recombinant Human CA8 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA8-142HCL | Recombinant Human CA8 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA8 Products
Required fields are marked with *
My Review for All CA8 Products
Required fields are marked with *