Recombinant Human CABP7, His-tagged

Cat.No. : CABP7-27794TH
Product Overview : Recombinant fragment corresponding to amino acids 1-188 of Human Calcium binding protein 7 with N terminal His tag; 208 amino acids with tag, MWt 23.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 188 amino acids
Description : CABP7, also known as Calcium-binding protein 7, contains two EF-hand domains. It negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity.
Conjugation : HIS
Molecular Weight : 23.700kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: PBS, pH 7.4
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKS
Sequence Similarities : Contains 2 EF-hand domains.
Gene Name CABP7 calcium binding protein 7 [ Homo sapiens ]
Official Symbol CABP7
Synonyms CABP7; calcium binding protein 7; calcium-binding protein 7; MGC57793;
Gene ID 164633
mRNA Refseq NM_182527
Protein Refseq NP_872333
Uniprot ID Q86V35
Chromosome Location 22q12.2
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CABP7 Products

Required fields are marked with *

My Review for All CABP7 Products

Required fields are marked with *

0
cart-icon