Recombinant Human CABP7 protein, His-tagged
Cat.No. : | CABP7-3180H |
Product Overview : | Recombinant Human CABP7 protein(1-189 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-189 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MPFHPVTAALMYRGIYTVPNLLSEQRPVDIPEDELEEIREAFKVFDRDGNGFISKQELGTAMRSLGYMPNEVELEVIIQRLDMDGDGQVDFEEFVTLLGPKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQIRQTCVRKSL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CABP7 calcium binding protein 7 [ Homo sapiens ] |
Official Symbol | CABP7 |
Synonyms | CABP7; calcium binding protein 7; calcium-binding protein 7; MGC57793; calneuron 2; calneuron-2; calneuron II; CALN2; |
Gene ID | 164633 |
mRNA Refseq | NM_182527 |
Protein Refseq | NP_872333 |
UniProt ID | Q86V35 |
◆ Recombinant Proteins | ||
CABP7-1063H | Recombinant Human CABP7 protein, GST-tagged | +Inquiry |
CABP7-27794TH | Recombinant Human CABP7, His-tagged | +Inquiry |
CABP7-0261H | Recombinant Human CABP7 Protein, GST-Tagged | +Inquiry |
CABP7-2769HF | Recombinant Full Length Human CABP7 Protein, GST-tagged | +Inquiry |
CABP7-3180H | Recombinant Human CABP7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CABP7-7907HCL | Recombinant Human CABP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CABP7 Products
Required fields are marked with *
My Review for All CABP7 Products
Required fields are marked with *