Recombinant Human CACFD1 Protein, GST-Tagged

• Cat.No.: CACFD1-0263H
• Product Overview: Human CACFD1 full-length ORF (NP_060056.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CACFD1 (Calcium Channel Flower Domain Containing 1) is a Protein Coding gene. Among its related pathways are Transmission across Chemical Synapses and DREAM Repression and Dynorphin Expression. GO annotations related to this gene include calcium channel activity.
• Molecular Mass: 44.9 kDa
• AA Sequence: MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CACFD1 calcium channel flower domain containing 1 [ Homo sapiens ]
• Official Symbol: CACFD1
• Synonyms: C9orf7; FLOWER; D9S2135
• Gene ID: 11094
• mRNA Refseq: NM_017586
• Protein Refseq: NP_060056
• MIM: 613104
• UniProt ID: Q9UGQ2