Recombinant Human CACFD1 Protein, GST-Tagged
Cat.No. : | CACFD1-0263H |
Product Overview : | Human CACFD1 full-length ORF (NP_060056.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CACFD1 (Calcium Channel Flower Domain Containing 1) is a Protein Coding gene. Among its related pathways are Transmission across Chemical Synapses and DREAM Repression and Dynorphin Expression. GO annotations related to this gene include calcium channel activity. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CACFD1 calcium channel flower domain containing 1 [ Homo sapiens ] |
Official Symbol | CACFD1 |
Synonyms | C9orf7; FLOWER; D9S2135 |
Gene ID | 11094 |
mRNA Refseq | NM_017586 |
Protein Refseq | NP_060056 |
MIM | 613104 |
UniProt ID | Q9UGQ2 |
◆ Recombinant Proteins | ||
CACFD1-1168M | Recombinant Mouse CACFD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACFD1-1061R | Recombinant Rat CACFD1 Protein | +Inquiry |
CACFD1-2606M | Recombinant Mouse CACFD1 Protein | +Inquiry |
CACFD1-5420H | Recombinant Human CACFD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL2486MF | Recombinant Full Length Mouse Calcium Channel Flower Homolog(Cacfd1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACFD1-7926HCL | Recombinant Human C9orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACFD1 Products
Required fields are marked with *
My Review for All CACFD1 Products
Required fields are marked with *