Recombinant Human CACFD1 Protein, GST-Tagged

Cat.No. : CACFD1-0263H
Product Overview : Human CACFD1 full-length ORF (NP_060056.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CACFD1 (Calcium Channel Flower Domain Containing 1) is a Protein Coding gene. Among its related pathways are Transmission across Chemical Synapses and DREAM Repression and Dynorphin Expression. GO annotations related to this gene include calcium channel activity.
Molecular Mass : 44.9 kDa
AA Sequence : MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CACFD1 calcium channel flower domain containing 1 [ Homo sapiens ]
Official Symbol CACFD1
Synonyms C9orf7; FLOWER; D9S2135
Gene ID 11094
mRNA Refseq NM_017586
Protein Refseq NP_060056
MIM 613104
UniProt ID Q9UGQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACFD1 Products

Required fields are marked with *

My Review for All CACFD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon