Recombinant Human CACNA1D protein, His-tagged
| Cat.No. : | CACNA1D-353H | 
| Product Overview : | Recombinant Human CACNA1D protein(Q01668)(Lys1561-Val1780), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Lys1561-Val1780 | 
| Tag : | C-His | 
| Form : | Phosphate buffered saline. | 
| Molecular Mass : | 26 kDa | 
| Storage : | Store at -20°C to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | KTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHV | 
| Gene Name | CACNA1D calcium channel, voltage-dependent, L type, alpha 1D subunit [ Homo sapiens ] | 
| Official Symbol | CACNA1D | 
| Synonyms | CACH3; CACN4; Cav1.3; CCHL1A2; CACNL1A2 | 
| Gene ID | 776 | 
| mRNA Refseq | NM_001128840.1 | 
| Protein Refseq | NP_001122312.1 | 
| MIM | 114206 | 
| UniProt ID | Q01668 | 
| ◆ Recombinant Proteins | ||
| CACNA1D-0466H | Recombinant Human CACNA1D Protein (Met1-Lys163), N-His-tagged | +Inquiry | 
| CACNA1D-6591C | Recombinant Chicken CACNA1D | +Inquiry | 
| CACNA1D-353H | Recombinant Human CACNA1D protein, His-tagged | +Inquiry | 
| CACNA1D-726R | Recombinant Rat CACNA1D Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CACNA1D-352H | Recombinant Human CACNA1A protein, His-GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA1D Products
Required fields are marked with *
My Review for All CACNA1D Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            