Recombinant Human CACNA1D protein, His-tagged

Cat.No. : CACNA1D-353H
Product Overview : Recombinant Human CACNA1D protein(Q01668)(Lys1561-Val1780), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Lys1561-Val1780
Tag : C-His
Form : Phosphate buffered saline.
Molecular Mass : 26 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHV
Gene Name CACNA1D calcium channel, voltage-dependent, L type, alpha 1D subunit [ Homo sapiens ]
Official Symbol CACNA1D
Synonyms CACH3; CACN4; Cav1.3; CCHL1A2; CACNL1A2
Gene ID 776
mRNA Refseq NM_001128840.1
Protein Refseq NP_001122312.1
MIM 114206
UniProt ID Q01668

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA1D Products

Required fields are marked with *

My Review for All CACNA1D Products

Required fields are marked with *

0
cart-icon