Recombinant Human CACYBP, His-tagged
| Cat.No. : | CACYBP-29815TH | 
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-228 of Human SIAH Interacting Protein with an N terminal His tag. Predicted MWt: 27 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-228 a.a. | 
| Description : | The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 100 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEI KNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLL VKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILC RKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNV LKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF | 
| Full Length : | Full L. | 
| Gene Name | CACYBP calcyclin binding protein [ Homo sapiens ] | 
| Official Symbol | CACYBP | 
| Synonyms | CACYBP; calcyclin binding protein; calcyclin-binding protein; S100A6BP; SIP; | 
| Gene ID | 27101 | 
| mRNA Refseq | NM_001007214 | 
| Protein Refseq | NP_001007215 | 
| MIM | 606186 | 
| Uniprot ID | Q9HB71 | 
| Chromosome Location | 1q24-q25 | 
| Pathway | Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; | 
| Function | protein binding; protein homodimerization activity; | 
| ◆ Recombinant Proteins | ||
| CACYBP-2533H | Recombinant Human Calcyclin Binding Protein | +Inquiry | 
| CACYBP-29815TH | Recombinant Human CACYBP, His-tagged | +Inquiry | 
| CACYBP-606R | Recombinant Rhesus monkey CACYBP Protein, His-tagged | +Inquiry | 
| CACYBP-844H | Recombinant Human CACYBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CACYBP-2442H | Recombinant Human CACYBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CACYBP-7898HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry | 
| CACYBP-7899HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACYBP Products
Required fields are marked with *
My Review for All CACYBP Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            