Recombinant Human CACYBP, His-tagged
Cat.No. : | CACYBP-29815TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-228 of Human SIAH Interacting Protein with an N terminal His tag. Predicted MWt: 27 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-228 a.a. |
Description : | The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 100 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEI KNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKISNY GWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLL VKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILC RKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNV LKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF |
Full Length : | Full L. |
Gene Name | CACYBP calcyclin binding protein [ Homo sapiens ] |
Official Symbol | CACYBP |
Synonyms | CACYBP; calcyclin binding protein; calcyclin-binding protein; S100A6BP; SIP; |
Gene ID | 27101 |
mRNA Refseq | NM_001007214 |
Protein Refseq | NP_001007215 |
MIM | 606186 |
Uniprot ID | Q9HB71 |
Chromosome Location | 1q24-q25 |
Pathway | Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
Function | protein binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
CACYBP-1178M | Recombinant Mouse CACYBP Protein, His (Fc)-Avi-tagged | +Inquiry |
Cacybp-739M | Recombinant Mouse Cacybp Protein, MYC/DDK-tagged | +Inquiry |
CACYBP-29815TH | Recombinant Human CACYBP, His-tagged | +Inquiry |
CACYBP-4456H | Recombinant Human CACYBP protein, His-tagged | +Inquiry |
CACYBP-0540H | Recombinant Human CACYBP Protein (Ala2-Phe228), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACYBP-7898HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
CACYBP-7899HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACYBP Products
Required fields are marked with *
My Review for All CACYBP Products
Required fields are marked with *