Recombinant Human CAD protein, SUMO-His-tagged

• Cat.No.: CAD-50H
• Product Overview: Recombinant Human CAD protein(Arg1661-Ser1900), fused with N-terminal SUMO tag and His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1661-1900 aa
• Form: Phosphate buffered saline
• Molecular Mass: 40 kDa
• AASequence: RPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASDPGLPAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQAS
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CAD carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [ Homo sapiens ]
• Official Symbol: CAD
• Synonyms: CAD; carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase; CAD protein; CAD trifunctional protein; multifunctional protein CAD
• mRNA Refseq: NM_004341
• Protein Refseq: NP_004332
• MIM: 114010
• UniProt ID: P27708
• Gene ID: 790