Recombinant Human CAD protein, SUMO-His-tagged

Cat.No. : CAD-50H
Product Overview : Recombinant Human CAD protein(Arg1661-Ser1900), fused with N-terminal SUMO tag and His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1661-1900 aa
Form : Phosphate buffered saline
Molecular Mass : 40 kDa
AASequence : RPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASDPGLPAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQAS
Storage : Store at -20°C/-80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name CAD carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [ Homo sapiens ]
Official Symbol CAD
Synonyms CAD; carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase; CAD protein; CAD trifunctional protein; multifunctional protein CAD;
mRNA Refseq NM_004341
Protein Refseq NP_004332
MIM 114010
UniProt ID P27708
Gene ID 790

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAD Products

Required fields are marked with *

My Review for All CAD Products

Required fields are marked with *

0
cart-icon
0
compare icon