Recombinant Human CAD protein, SUMO-His-tagged
Cat.No. : | CAD-50H |
Product Overview : | Recombinant Human CAD protein(Arg1661-Ser1900), fused with N-terminal SUMO tag and His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1661-1900 aa |
Form : | Phosphate buffered saline |
Molecular Mass : | 40 kDa |
AASequence : | RPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASDPGLPAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQAS |
Storage : | Store at -20°C/-80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | CAD carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase [ Homo sapiens ] |
Official Symbol | CAD |
Synonyms | CAD; carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase; CAD protein; CAD trifunctional protein; multifunctional protein CAD; |
mRNA Refseq | NM_004341 |
Protein Refseq | NP_004332 |
MIM | 114010 |
UniProt ID | P27708 |
Gene ID | 790 |
◆ Recombinant Proteins | ||
CAD-2323H | Recombinant Human CAD protein, His-tagged | +Inquiry |
CAD-50H | Recombinant Human CAD protein, SUMO-His-tagged | +Inquiry |
CAD-49H | Recombinant Human CAD protein, His-tagged | +Inquiry |
CAD-5857H | Recombinant Human CAD protein, His&Myc-tagged | +Inquiry |
CAD-10649H | Recombinant Human CAD, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAD Products
Required fields are marked with *
My Review for All CAD Products
Required fields are marked with *
0
Inquiry Basket