Recombinant Human CALCB protein, GST-tagged
| Cat.No. : | CALCB-2621H |
| Product Overview : | Recombinant Human CALCB protein(P10092)(1-127aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-127aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.7 kDa |
| AA Sequence : | MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CALCB calcitonin-related polypeptide beta [ Homo sapiens ] |
| Official Symbol | CALCB |
| Synonyms | CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II; |
| Gene ID | 797 |
| mRNA Refseq | NM_000728 |
| Protein Refseq | NP_000719 |
| MIM | 114160 |
| UniProt ID | P10092 |
| ◆ Recombinant Proteins | ||
| CALCB-752R | Recombinant Rat CALCB Protein, His (Fc)-Avi-tagged | +Inquiry |
| Calcb-7866R | Recombinant Rat Calcb protein, His-tagged | +Inquiry |
| CALCB-3048HF | Recombinant Full Length Human CALCB Protein, GST-tagged | +Inquiry |
| CALCB-0291H | Recombinant Human CALCB Protein, GST-Tagged | +Inquiry |
| CALCB-818H | Recombinant Human CALCB Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALCB-793HCL | Recombinant Human CALCB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCB Products
Required fields are marked with *
My Review for All CALCB Products
Required fields are marked with *
