Recombinant Human CALCOCO2, His-tagged
| Cat.No. : | CALCOCO2-27798TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 191-446 of Human CALCOCO2 with an N terminal His tag. Observed mwt: 34kDa ; | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 191-446 a.a. | 
| Description : | The protein encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles. | 
| Conjugation : | HIS | 
| Tissue specificity : | Expressed in all tissues tested with highest expression in skeletal muscle and lowest in brain. | 
| Form : | Lyophilised:Reconstitute with 95 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | NKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRV DQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHL FLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLL SYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQ ESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCFNCPICDKIFPATEKQIFEDHVFCHSL | 
| Gene Name | CALCOCO2 calcium binding and coiled-coil domain 2 [ Homo sapiens ] | 
| Official Symbol | CALCOCO2 | 
| Synonyms | CALCOCO2; calcium binding and coiled-coil domain 2; calcium-binding and coiled-coil domain-containing protein 2; MGC17318; NDP52; | 
| Gene ID | 10241 | 
| mRNA Refseq | NM_005831 | 
| Protein Refseq | NP_005822 | 
| MIM | 604587 | 
| Uniprot ID | Q13137 | 
| Chromosome Location | 17q21.32 | 
| Function | protein binding; protein homodimerization activity; | 
| ◆ Recombinant Proteins | ||
| CALCOCO2-2884Z | Recombinant Zebrafish CALCOCO2 | +Inquiry | 
| Calcoco2-1936M | Recombinant Mouse Calcoco2 Protein, Myc/DDK-tagged | +Inquiry | 
| CALCOCO2-3050HF | Recombinant Full Length Human CALCOCO2 Protein, GST-tagged | +Inquiry | 
| CALCOCO2-27798TH | Recombinant Human CALCOCO2, His-tagged | +Inquiry | 
| CALCOCO2-770HFL | Recombinant Full Length Human CALCOCO2 Protein, C-Flag-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CALCOCO2-7893HCL | Recombinant Human CALCOCO2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCOCO2 Products
Required fields are marked with *
My Review for All CALCOCO2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            