Recombinant Human CALM1 protein, GST-tagged
| Cat.No. : | CALM1-10668H |
| Product Overview : | Recombinant Human CALM1 protein(20-139 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 20-139 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNY |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Publications : |
| Gene Name | CALM1 calmodulin 1 (phosphorylase kinase, delta) [ Homo sapiens ] |
| Official Symbol | CALM1 |
| Synonyms | CALM1; calmodulin 1 (phosphorylase kinase, delta); CALML2; calmodulin; CAMI; DD132; PHKD; phosphorylase kinase, delta subunit; caM; CALM2; CALM3; |
| Gene ID | 801 |
| mRNA Refseq | NM_006888 |
| Protein Refseq | NP_008819 |
| MIM | 114180 |
| UniProt ID | P62158 |
| ◆ Recombinant Proteins | ||
| CALM1-2721H | Recombinant Human CALM1 Protein, His-tagged | +Inquiry |
| CALM1-757R | Recombinant Rat CALM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CALM1-1093R | Recombinant Rat CALM1 Protein | +Inquiry |
| CALM1-5358H | Recombinant Human CALM1 protein, His-tagged | +Inquiry |
| CALM1-7968C | Recombinant Chicken CALM1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALM1-7890HCL | Recombinant Human CALM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALM1 Products
Required fields are marked with *
My Review for All CALM1 Products
Required fields are marked with *
