Recombinant Human CALM1 protein, His-tagged
Cat.No. : | CALM1-1069H |
Product Overview : | Recombinant Human CALM1 protein(20-139 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-139 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | FDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CALM1 calmodulin 1 (phosphorylase kinase, delta) [ Homo sapiens ] |
Official Symbol | CALM1 |
Synonyms | CALM1; calmodulin 1 (phosphorylase kinase, delta); CALML2; calmodulin; CAMI; DD132; PHKD; phosphorylase kinase, delta subunit; caM; CALM2; CALM3; |
Gene ID | 801 |
mRNA Refseq | NM_006888 |
Protein Refseq | NP_008819 |
MIM | 114180 |
UniProt ID | P62158 |
◆ Recombinant Proteins | ||
CALM1-89H | Recombinant Human CALM1, His-tagged | +Inquiry |
CALM1-90H | Recombinant Human CALM1 | +Inquiry |
CALM1-0817H | Recombinant Human CALM1 Protein (Ala2-Lys149), His tagged | +Inquiry |
Calm1-7971R | Recombinant Rat Calm1 protein, His-tagged | +Inquiry |
Calm1-2623R | Recombinant Rat Calm1 protein, His-SUMO & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALM1-7890HCL | Recombinant Human CALM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALM1 Products
Required fields are marked with *
My Review for All CALM1 Products
Required fields are marked with *