Recombinant Human CALM2 Protein, GST-Tagged
Cat.No. : | CALM2-0304H |
Product Overview : | Human CALM2 full-length ORF (AAH03354, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the calmodulin gene family. There are three distinct calmodulin genes dispersed throughout the genome that encode the identical protein, but differ at the nucleotide level. Calmodulin is a calcium binding protein that plays a role in signaling pathways, cell cycle progression and proliferation. Several infants with severe forms of long-QT syndrome (LQTS) who displayed life-threatening ventricular arrhythmias together with delayed neurodevelopment and epilepsy were found to have mutations in either this gene or another member of the calmodulin gene family (PMID:23388215). Mutations in this gene have also been identified in patients with less severe forms of LQTS (PMID:24917665), while mutations in another calmodulin gene family member have been associated with catecholaminergic polymorphic ventricular tachycardia (CPVT)(PMID:23040497), a rare disorder thought to be the cause of a significant fraction of sudden cardiac deaths in young individuals. Pseudogenes of this gene are found on chromosomes 10, 13, and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2015] |
Molecular Mass : | 42.13 kDa |
AA Sequence : | MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKVKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CALM2 calmodulin 2 (phosphorylase kinase, delta) [ Homo sapiens ] |
Official Symbol | CALM2 |
Synonyms | CALM2; calmodulin 2 (phosphorylase kinase, delta); calmodulin; CAMII; PHKD; caM; LP7057 protein; phosphorylase kinase delta; CALM1; CALM3; PHKD2; FLJ99410; |
Gene ID | 805 |
mRNA Refseq | NM_001743 |
Protein Refseq | NP_001734 |
MIM | 114182 |
UniProt ID | P62158 |
◆ Recombinant Proteins | ||
CALM2-571H | Recombinant Human CALM2, His tagged | +Inquiry |
CALM2-1169H | Recombinant Human CALM2 protein, His-tagged | +Inquiry |
CALM2-1094R | Recombinant Rat CALM2 Protein | +Inquiry |
CALM2-3358H | Recombinant Human CALM2 protein | +Inquiry |
CALM2-758R | Recombinant Rat CALM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALM2-7889HCL | Recombinant Human CALM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALM2 Products
Required fields are marked with *
My Review for All CALM2 Products
Required fields are marked with *