Recombinant Human CALM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CALM2-4558H |
Product Overview : | CALM2 MS Standard C13 and N15-labeled recombinant protein (NP_001734) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the calmodulin gene family. There are three distinct calmodulin genes dispersed throughout the genome that encode the identical protein, but differ at the nucleotide level. Calmodulin is a calcium binding protein that plays a role in signaling pathways, cell cycle progression and proliferation. Several infants with severe forms of long-QT syndrome (LQTS) who displayed life-threatening ventricular arrhythmias together with delayed neurodevelopment and epilepsy were found to have mutations in either this gene or another member of the calmodulin gene family (PMID:23388215). Mutations in this gene have also been identified in patients with less severe forms of LQTS (PMID:24917665), while mutations in another calmodulin gene family member have been associated with catecholaminergic polymorphic ventricular tachycardia (CPVT)(PMID:23040497), a rare disorder thought to be the cause of a significant fraction of sudden cardiac deaths in young individuals. Pseudogenes of this gene are found on chromosomes 10, 13, and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 16.8 kDa |
AA Sequence : | MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CALM2 calmodulin 2 [ Homo sapiens (human) ] |
Official Symbol | CALM2 |
Synonyms | CALM2; calmodulin 2 (phosphorylase kinase, delta); calmodulin; CAMII; PHKD; caM; LP7057 protein; phosphorylase kinase delta; CALM1; CALM3; PHKD2; FLJ99410; |
Gene ID | 805 |
mRNA Refseq | NM_001743 |
Protein Refseq | NP_001734 |
MIM | 114182 |
UniProt ID | P62158 |
◆ Recombinant Proteins | ||
CALM2-3358H | Recombinant Human CALM2 protein | +Inquiry |
CALM2-10669H | Recombinant Human CALM2 protein, GST-tagged | +Inquiry |
CALM2-0304H | Recombinant Human CALM2 Protein, GST-Tagged | +Inquiry |
CALM2-2651M | Recombinant Mouse CALM2 Protein | +Inquiry |
CALM2-571H | Recombinant Human CALM2, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALM2-7889HCL | Recombinant Human CALM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALM2 Products
Required fields are marked with *
My Review for All CALM2 Products
Required fields are marked with *
0
Inquiry Basket