Recombinant Human CALML3

• Cat.No.: CALML3-26630TH
• Product Overview: Recombinant full length Human CALML3 with a N terminal proprietary tag; Predicted MWt 42.13 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 149 amino acids
• Description: Calmodulin-like protein 3 is a protein that in humans is encoded by the CALML3 gene.
• Molecular Weight: 42.130kDa inclusive of tags
• Tissue specificity: Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSL GQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDT DNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE EVDEMIRAADTDGDGQVNYEEFVRVLVSK
• Sequence Similarities: Belongs to the calmodulin family.Contains 4 EF-hand domains.

Gene Information

• Gene Name: CALML3 calmodulin-like 3 [ Homo sapiens ]
• Official Symbol: CALML3
• Synonyms: CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP
• Gene ID: 810
• mRNA Refseq: NM_005185
• Protein Refseq: NP_005176
• MIM: 114184
• Uniprot ID: P27482
• Chromosome Location: 10pter-p13
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Dopaminergic synapse, organism-specific biosystem
• Function: calcium ion binding