Recombinant Human CALML3
| Cat.No. : | CALML3-26630TH |
| Product Overview : | Recombinant full length Human CALML3 with a N terminal proprietary tag; Predicted MWt 42.13 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 149 amino acids |
| Description : | Calmodulin-like protein 3 is a protein that in humans is encoded by the CALML3 gene. |
| Molecular Weight : | 42.130kDa inclusive of tags |
| Tissue specificity : | Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSL GQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDT DNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDE EVDEMIRAADTDGDGQVNYEEFVRVLVSK |
| Sequence Similarities : | Belongs to the calmodulin family.Contains 4 EF-hand domains. |
| Gene Name | CALML3 calmodulin-like 3 [ Homo sapiens ] |
| Official Symbol | CALML3 |
| Synonyms | CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP; |
| Gene ID | 810 |
| mRNA Refseq | NM_005185 |
| Protein Refseq | NP_005176 |
| MIM | 114184 |
| Uniprot ID | P27482 |
| Chromosome Location | 10pter-p13 |
| Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Dopaminergic synapse, organism-specific biosystem; |
| Function | calcium ion binding; |
| ◆ Recombinant Proteins | ||
| CALML3-1193M | Recombinant Mouse CALML3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CALML3-7076H | Recombinant Human CALML3, His-tagged | +Inquiry |
| CALML3-464H | Recombinant Human CALML3 protein, His-tagged | +Inquiry |
| CALML3-1096R | Recombinant Rat CALML3 Protein | +Inquiry |
| CALML3-10671H | Recombinant Human CALML3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CALML3-7887HCL | Recombinant Human CALML3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALML3 Products
Required fields are marked with *
My Review for All CALML3 Products
Required fields are marked with *
