Recombinant Human CALML3 Protein, GST-Tagged
Cat.No. : | CALML3-0306H |
Product Overview : | Human CALML3 full-length ORF (AAH31889, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CALML3 (Calmodulin Like 3) is a Protein Coding gene. Among its related pathways are Vascular smooth muscle contraction and Tuberculosis. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CALM1. |
Molecular Mass : | 42.13 kDa |
AA Sequence : | MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CALML3 calmodulin-like 3 [ Homo sapiens ] |
Official Symbol | CALML3 |
Synonyms | CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP; caM-like protein; calmodulin-related protein NB-1; |
Gene ID | 810 |
mRNA Refseq | NM_005185 |
Protein Refseq | NP_005176 |
MIM | 114184 |
UniProt ID | P27482 |
◆ Recombinant Proteins | ||
CALML3-10671H | Recombinant Human CALML3, GST-tagged | +Inquiry |
CALML3-47HF | Recombinant Full Length Human CALML3 Protein | +Inquiry |
CALML3-26630TH | Recombinant Human CALML3 | +Inquiry |
CALML3-7076H | Recombinant Human CALML3, His-tagged | +Inquiry |
CALML3-0306H | Recombinant Human CALML3 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALML3-7887HCL | Recombinant Human CALML3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALML3 Products
Required fields are marked with *
My Review for All CALML3 Products
Required fields are marked with *
0
Inquiry Basket