Recombinant Human CALY Protein, GST-Tagged
| Cat.No. : | CALY-0316H |
| Product Overview : | Human CALY full-length ORF (AAH38978.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 50.27 kDa |
| AA Sequence : | MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CALY calcyon neuron-specific vesicular protein [ Homo sapiens ] |
| Official Symbol | CALY |
| Synonyms | CALY; calcyon neuron-specific vesicular protein; dopamine receptor D1 interacting protein, DRD1IP; neuron-specific vesicular protein calcyon; CALCYON; NSG3; calcyon protein; D1 dopamine receptor-interacting protein; dopamine receptor D1 interacting protein; calcyon D1 dopamine receptor-interacting protein (CALCYON); DRD1IP; RP11-122K13.5; |
| Gene ID | 50632 |
| mRNA Refseq | NM_015722 |
| Protein Refseq | NP_056537 |
| MIM | 604647 |
| UniProt ID | Q9NYX4 |
| ◆ Recombinant Proteins | ||
| CALY-1098R | Recombinant Rat CALY Protein | +Inquiry |
| CALY-2285H | Recombinant Human CALY Protein, MYC/DDK-tagged | +Inquiry |
| CALY-440R | Recombinant Rhesus Macaque CALY Protein, His (Fc)-Avi-tagged | +Inquiry |
| CALY-1195M | Recombinant Mouse CALY Protein, His (Fc)-Avi-tagged | +Inquiry |
| Caly-1102R | Recombinant Rat Caly protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALY Products
Required fields are marked with *
My Review for All CALY Products
Required fields are marked with *
