Recombinant Human CAMK1D Protein, GST-tagged

• Cat.No.: CAMK1D-404H
• Product Overview: Recombinant Human CAMK1D, transcript variant 2, fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
• Form: Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 69.2kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMARENGESSSSWKKQAEDIKKIFEFKETL
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: CAMK1D calcium/calmodulin-dependent protein kinase ID [ Homo sapiens ]
• Official Symbol: CAMK1D
• Synonyms: CAMK1D; calcium/calmodulin-dependent protein kinase ID; calcium/calmodulin-dependent protein kinase type 1D; CKLiK; caMKI delta; caM-KI delta; CaM kinase ID; caM kinase I delta; CamKI-like protein kinase; CaM-K1; CaMKID
• Gene ID: 57118
• mRNA Refseq: NM_020397
• Protein Refseq: NP_065130
• MIM: 607957
• UniProt ID: Q8IU85