Recombinant Human CAMK1D Protein, GST-tagged

Cat.No. : CAMK1D-404H
Product Overview : Recombinant Human CAMK1D, transcript variant 2, fused with GST tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Form : Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 69.2kD
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMARENGESSSSWKKQAEDIKKIFEFKETL
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name CAMK1D calcium/calmodulin-dependent protein kinase ID [ Homo sapiens ]
Official Symbol CAMK1D
Synonyms CAMK1D; calcium/calmodulin-dependent protein kinase ID; calcium/calmodulin-dependent protein kinase type 1D; CKLiK; caMKI delta; caM-KI delta; CaM kinase ID; caM kinase I delta; CamKI-like protein kinase; CaM-K1; CaMKID;
Gene ID 57118
mRNA Refseq NM_020397
Protein Refseq NP_065130
MIM 607957
UniProt ID Q8IU85

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAMK1D Products

Required fields are marked with *

My Review for All CAMK1D Products

Required fields are marked with *

0
cart-icon