Recombinant Human CAMK2N2 protein, GST-tagged
| Cat.No. : | CAMK2N2-301339H |
| Product Overview : | Recombinant Human CAMK2N2 (1-79 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Val79 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | CAMK2N2 calcium/calmodulin-dependent protein kinase II inhibitor 2 [ Homo sapiens ] |
| Official Symbol | CAMK2N2 |
| Synonyms | CAMK2N2; calcium/calmodulin-dependent protein kinase II inhibitor 2; CaM KIIN; CaM-KII inhibitory protein; CAMKIIN; CAM-KIIN; |
| Gene ID | 94032 |
| mRNA Refseq | NM_033259 |
| Protein Refseq | NP_150284 |
| MIM | 608721 |
| UniProt ID | Q96S95 |
| ◆ Recombinant Proteins | ||
| CAMK2N2-444R | Recombinant Rhesus Macaque CAMK2N2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Camk2n2-1945M | Recombinant Mouse Camk2n2 Protein, Myc/DDK-tagged | +Inquiry |
| CAMK2N2-2491H | Recombinant Human CAMK2N2 Protein, MYC/DDK-tagged | +Inquiry |
| CAMK2N2-1105R | Recombinant Rat CAMK2N2 Protein | +Inquiry |
| CAMK2N2-616R | Recombinant Rhesus monkey CAMK2N2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAMK2N2-144HCL | Recombinant Human CAMK2N2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMK2N2 Products
Required fields are marked with *
My Review for All CAMK2N2 Products
Required fields are marked with *
