Recombinant Human CAMK2N2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CAMK2N2-5607H
• Product Overview: CAMK2N2 MS Standard C13 and N15-labeled recombinant protein (NP_150284) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors.
• Molecular Mass: 8.7 kDa
• AA Sequence: MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CAMK2N2 calcium/calmodulin-dependent protein kinase II inhibitor 2 [ Homo sapiens (human) ]
• Official Symbol: CAMK2N2
• Synonyms: CAMK2N2; calcium/calmodulin-dependent protein kinase II inhibitor 2; CaM KIIN; CaM-KII inhibitory protein; CAMKIIN; CAM-KIIN
• Gene ID: 94032
• mRNA Refseq: NM_033259
• Protein Refseq: NP_150284
• MIM: 608721
• UniProt ID: Q96S95