Recombinant Human CAMLG protein, His-tagged

• Cat.No.: CAMLG-5763H
• Product Overview: Recombinant Human CAMLG protein(1-184 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-184 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CAMLG calcium modulating ligand [ Homo sapiens ]
• Official Symbol: CAMLG
• Synonyms: CAMLG; calcium modulating ligand; calcium signal-modulating cyclophilin ligand; calcium modulating cyclophilin ligand; calcium signal modulating cyclophilin ligand; CAML; cyclophilin B binding protein; cyclophilin B-binding protein; calcium-modulating cyclophilin ligand; calcium-signal modulating cyclophilin ligand; MGC163197
• Gene ID: 819
• mRNA Refseq: NM_001745
• Protein Refseq: NP_001736
• MIM: 601118
• UniProt ID: P49069