Recombinant Human CAMLG Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CAMLG-1925H
• Product Overview: CAMLG MS Standard C13 and N15-labeled recombinant protein (NP_001736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.
• Molecular Mass: 33 kDa
• AA Sequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CAMLG calcium modulating ligand [ Homo sapiens (human) ]
• Official Symbol: CAMLG
• Synonyms: CAMLG; calcium modulating ligand; calcium signal-modulating cyclophilin ligand; calcium modulating cyclophilin ligand; calcium signal modulating cyclophilin ligand; CAML; cyclophilin B binding protein; cyclophilin B-binding protein; calcium-modulating cyclophilin ligand; calcium-signal modulating cyclophilin ligand; MGC163197
• Gene ID: 819
• mRNA Refseq: NM_001745
• Protein Refseq: NP_001736
• MIM: 601118
• UniProt ID: P49069