Recombinant Human CAMLG Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CAMLG-1925H
Product Overview : CAMLG MS Standard C13 and N15-labeled recombinant protein (NP_001736) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.
Molecular Mass : 33 kDa
AA Sequence : MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CAMLG calcium modulating ligand [ Homo sapiens (human) ]
Official Symbol CAMLG
Synonyms CAMLG; calcium modulating ligand; calcium signal-modulating cyclophilin ligand; calcium modulating cyclophilin ligand; calcium signal modulating cyclophilin ligand; CAML; cyclophilin B binding protein; cyclophilin B-binding protein; calcium-modulating cyclophilin ligand; calcium-signal modulating cyclophilin ligand; MGC163197;
Gene ID 819
mRNA Refseq NM_001745
Protein Refseq NP_001736
MIM 601118
UniProt ID P49069

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAMLG Products

Required fields are marked with *

My Review for All CAMLG Products

Required fields are marked with *

0
cart-icon
0
compare icon