Recombinant Human CAND1 Protein, GST-Tagged
Cat.No. : | CAND1-0347H |
Product Overview : | Human CAND1 partial ORF (NP_060918, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an essential regulator of Cullin-RING ubiquitin ligases, which are in involved in ubiquitinylation of proteins degraded by the Ub proteasome system. The encoded protein binds to unneddylated cullin-RING box protein complexes and acts as an inhibitor of cullin neddylation and of Skp1, cullin, and F box ubiquitin ligase complex assembly and activity. In mammalian cell culture, this protein predominantly localizes to the cytoplasm. Knockdown of this gene in preadipocytes results in blocked adipogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAND1 cullin-associated and neddylation-dissociated 1 [ Homo sapiens ] |
Official Symbol | CAND1 |
Synonyms | CAND1; cullin-associated and neddylation-dissociated 1; cullin-associated NEDD8-dissociated protein 1; DKFZp434M1414; KIAA0829; TBP interacting protein; TIP120; TIP120A; p120 CAND1; TBP-interacting protein 120A; TBP-interacting protein of 120 kDa A; cullin-associated and neddylation-dissociated protein 1; FLJ10114; FLJ10929; FLJ38691; FLJ90441; |
Gene ID | 55832 |
mRNA Refseq | NM_018448 |
Protein Refseq | NP_060918 |
MIM | 607727 |
UniProt ID | Q86VP6 |
◆ Recombinant Proteins | ||
CAND1-1207M | Recombinant Mouse CAND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAND1-2683M | Recombinant Mouse CAND1 Protein | +Inquiry |
CAND1-0347H | Recombinant Human CAND1 Protein, GST-Tagged | +Inquiry |
CAND1-775R | Recombinant Rat CAND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAND1-449R | Recombinant Rhesus Macaque CAND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAND1-7869HCL | Recombinant Human CAND1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAND1 Products
Required fields are marked with *
My Review for All CAND1 Products
Required fields are marked with *