Recombinant Human CAPSL Protein, GST-Tagged
| Cat.No. : | CAPSL-0381H |
| Product Overview : | Human CAPSL full-length ORF (AAH17586.2, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CAPSL (Calcyphosine Like) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CAPS. |
| Molecular Mass : | 49.5 kDa |
| AA Sequence : | MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CAPSL calcyphosine-like [ Homo sapiens ] |
| Official Symbol | CAPSL |
| Synonyms | CAPSL; calcyphosine-like; calcyphosin-like protein; MGC26610; |
| Gene ID | 133690 |
| mRNA Refseq | NM_001042625 |
| Protein Refseq | NP_001036090 |
| UniProt ID | Q8WWF8 |
| ◆ Recombinant Proteins | ||
| Capsl-1956M | Recombinant Mouse Capsl Protein, Myc/DDK-tagged | +Inquiry |
| CAPSL-2588H | Recombinant Human CAPSL Protein, His (Fc)-Avi-tagged | +Inquiry |
| CAPSL-1384H | Recombinant Human CAPSL | +Inquiry |
| CAPSL-4678H | Recombinant Human CAPSL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CAPSL-10713H | Recombinant Human CAPSL, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAPSL-7854HCL | Recombinant Human CAPSL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPSL Products
Required fields are marked with *
My Review for All CAPSL Products
Required fields are marked with *
