Recombinant Human CAPSL Protein, GST-Tagged
Cat.No. : | CAPSL-0381H |
Product Overview : | Human CAPSL full-length ORF (AAH17586.2, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CAPSL (Calcyphosine Like) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CAPS. |
Molecular Mass : | 49.5 kDa |
AA Sequence : | MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAPSL calcyphosine-like [ Homo sapiens ] |
Official Symbol | CAPSL |
Synonyms | CAPSL; calcyphosine-like; calcyphosin-like protein; MGC26610; |
Gene ID | 133690 |
mRNA Refseq | NM_001042625 |
Protein Refseq | NP_001036090 |
UniProt ID | Q8WWF8 |
◆ Recombinant Proteins | ||
CAPSL-2588H | Recombinant Human CAPSL Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPSL-3488H | Recombinant Human CAPSL, His-tagged | +Inquiry |
CAPSL-2846HF | Recombinant Full Length Human CAPSL Protein, GST-tagged | +Inquiry |
CAPSL-2706M | Recombinant Mouse CAPSL Protein | +Inquiry |
CAPSL-0381H | Recombinant Human CAPSL Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPSL-7854HCL | Recombinant Human CAPSL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPSL Products
Required fields are marked with *
My Review for All CAPSL Products
Required fields are marked with *