Recombinant Human CAPZA1 protein, T7-tagged
| Cat.No. : | CAPZA1-118H |
| Product Overview : | Recombinant human CAPZA1 fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQ FTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHY SNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKD VQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for human F actin assembling regulation study in vitro2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used as cancer biomarker for diagnosis application development, such as melanoma. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | CAPZA1 capping protein (actin filament) muscle Z-line, alpha 1 [ Homo sapiens ] |
| Official Symbol | CAPZA1 |
| Synonyms | CAPZA1; capping protein (actin filament) muscle Z-line, alpha 1; F-actin-capping protein subunit alpha-1; Cap Z; capZ alpha-1; CAPZ; CAZ1; CAPPA1; |
| Gene ID | 829 |
| mRNA Refseq | NM_006135 |
| Protein Refseq | NP_006126 |
| MIM | 601580 |
| UniProt ID | P52907 |
| Chromosome Location | 1p13.2 |
| Pathway | Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; |
| Function | actin binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPZA1 Products
Required fields are marked with *
My Review for All CAPZA1 Products
Required fields are marked with *



