"CAPZA1" Related Products

Expand
Expand
Expand

Recombinant Human CAPZA1 protein, T7-tagged

Cat.No.: CAPZA1-118H
Product Overview: Recombinant human CAPZA1 fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQ FTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHY SNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKD VQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Purity: >90% by SDS-PAGE
Applications: 1. May be used for human F actin assembling regulation study in vitro2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used as cancer biomarker for diagnosis application development, such as melanoma.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CAPZA1 capping protein (actin filament) muscle Z-line, alpha 1 [ Homo sapiens ]
Official Symbol: CAPZA1
Synonyms: CAPZA1; capping protein (actin filament) muscle Z-line, alpha 1; F-actin-capping protein subunit alpha-1; Cap Z; capZ alpha-1; CAPZ; CAZ1; CAPPA1;
Gene ID: 829
mRNA Refseq: NM_006135
Protein Refseq: NP_006126
MIM: 601580
UniProt ID: P52907
Chromosome Location: 1p13.2
Pathway: Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem;
Function: actin binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.