Recombinant Human CAPZA1 protein, T7-tagged

Cat.No. : CAPZA1-118H
Product Overview : Recombinant human CAPZA1 fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQ FTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHY SNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKD VQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Purity : >90% by SDS-PAGE
Applications : 1. May be used for human F actin assembling regulation study in vitro2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used as cancer biomarker for diagnosis application development, such as melanoma.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CAPZA1 capping protein (actin filament) muscle Z-line, alpha 1 [ Homo sapiens ]
Official Symbol CAPZA1
Synonyms CAPZA1; capping protein (actin filament) muscle Z-line, alpha 1; F-actin-capping protein subunit alpha-1; Cap Z; capZ alpha-1; CAPZ; CAZ1; CAPPA1;
Gene ID 829
mRNA Refseq NM_006135
Protein Refseq NP_006126
MIM 601580
UniProt ID P52907
Chromosome Location 1p13.2
Pathway Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem;
Function actin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAPZA1 Products

Required fields are marked with *

My Review for All CAPZA1 Products

Required fields are marked with *

0
cart-icon