Recombinant Human CAPZA1 protein, T7-tagged
Cat.No. : | CAPZA1-118H |
Product Overview : | Recombinant human CAPZA1 fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQ FTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHY SNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKD VQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for human F actin assembling regulation study in vitro2. May be used as specific substrate protein for kinase and ubiquitin enzymes.3. May be used as cancer biomarker for diagnosis application development, such as melanoma. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CAPZA1 capping protein (actin filament) muscle Z-line, alpha 1 [ Homo sapiens ] |
Official Symbol | CAPZA1 |
Synonyms | CAPZA1; capping protein (actin filament) muscle Z-line, alpha 1; F-actin-capping protein subunit alpha-1; Cap Z; capZ alpha-1; CAPZ; CAZ1; CAPPA1; |
Gene ID | 829 |
mRNA Refseq | NM_006135 |
Protein Refseq | NP_006126 |
MIM | 601580 |
UniProt ID | P52907 |
Chromosome Location | 1p13.2 |
Pathway | Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; |
Function | actin binding; |
◆ Recombinant Proteins | ||
CAPZA1&CAPZB-869H | Active Recombinant Human CAPZA1/CAPZB Protein, His-tagged | +Inquiry |
CAPZA1-0841H | Recombinant Human CAPZA1 Protein (Met1-Ala286), N-His tagged | +Inquiry |
CAPZA1-0382H | Recombinant Human CAPZA1 Protein, GST-Tagged | +Inquiry |
CAPZA1-1381HFL | Recombinant Full Length Human CAPZA1 Protein, C-Flag-tagged | +Inquiry |
CAPZA1-626R | Recombinant Rhesus monkey CAPZA1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPZA1-7853HCL | Recombinant Human CAPZA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPZA1 Products
Required fields are marked with *
My Review for All CAPZA1 Products
Required fields are marked with *
0
Inquiry Basket