Recombinant Human CARD11 Protein, GST-Tagged
Cat.No. : | CARD11-0391H |
Product Overview : | Human CARD11 partial ORF (NP_115791, 481 a.a. - 580 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein has a domain structure similar to that of CARD14 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCGSLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CARD11 caspase recruitment domain family, member 11 [ Homo sapiens ] |
Official Symbol | CARD11 |
Synonyms | CARD11; caspase recruitment domain family, member 11; caspase recruitment domain-containing protein 11; bcl10 interacting maguk protein 3; BIMP3; card maguk protein 1; CARMA1; carma 1; card-maguk protein 1; CARD-containing MAGUK protein 1; bcl10-interacting maguk protein 3; MGC133069; |
Gene ID | 84433 |
mRNA Refseq | NM_032415 |
Protein Refseq | NP_115791 |
MIM | 607210 |
UniProt ID | Q9BXL7 |
◆ Recombinant Proteins | ||
CARD11-1312C | Recombinant Chicken CARD11 | +Inquiry |
CARD11-10718H | Recombinant Human CARD11, His-tagged | +Inquiry |
CARD11-01H | Recombinant Human CARD11 Protein, Myc/DDK-tagged | +Inquiry |
CARD11-301642H | Recombinant Human CARD11 protein, GST-tagged | +Inquiry |
CARD11-6717H | Recombinant Human CARD11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARD11-7850HCL | Recombinant Human CARD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CARD11 Products
Required fields are marked with *
My Review for All CARD11 Products
Required fields are marked with *
0
Inquiry Basket