Recombinant Human CARD11 protein, His-tagged
Cat.No. : | CARD11-7865H |
Product Overview : | Recombinant Human CARD11 protein(798-1147 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 798-1147 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | DTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQLLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSLIPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKTETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCEKNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIGEEQRKTIWVDEDQL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | CARD11 caspase recruitment domain family, member 11 [ Homo sapiens ] |
Official Symbol | CARD11 |
Synonyms | CARD11; caspase recruitment domain family, member 11; caspase recruitment domain-containing protein 11; bcl10 interacting maguk protein 3; BIMP3; card maguk protein 1; CARMA1; carma 1; card-maguk protein 1; CARD-containing MAGUK protein 1; bcl10-interacting maguk protein 3; MGC133069; |
mRNA Refseq | NM_032415 |
Protein Refseq | NP_115791 |
MIM | 607210 |
UniProt ID | Q9BXL7 |
Gene ID | 84433 |
◆ Recombinant Proteins | ||
CARD11-01H | Recombinant Human CARD11 Protein, Myc/DDK-tagged | +Inquiry |
CARD11-6717H | Recombinant Human CARD11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CARD11-2728M | Recombinant Mouse CARD11 Protein | +Inquiry |
CARD11-0391H | Recombinant Human CARD11 Protein, GST-Tagged | +Inquiry |
Card11-385M | Recombinant Mouse Card11 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARD11-7850HCL | Recombinant Human CARD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARD11 Products
Required fields are marked with *
My Review for All CARD11 Products
Required fields are marked with *