Recombinant Human CARD16 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CARD16-6035H |
| Product Overview : | CARD16 MS Standard C13 and N15-labeled recombinant protein (NP_443121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | CARD16 (Caspase Recruitment Domain Family Member 16) is a Protein Coding gene. Diseases associated with CARD16 include Nodular Lymphocyte Predominant Hodgkin Lymphoma and Panhypopituitarism, X-Linked. Among its related pathways are NOD-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CASP1. |
| Molecular Mass : | 10.6 kDa |
| AA Sequence : | MRKAMADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CARD16 caspase recruitment domain family member 16 [ Homo sapiens (human) ] |
| Official Symbol | CARD16 |
| Synonyms | CARD16; caspase recruitment domain family, member 16; caspase recruitment domain-containing protein 16; COP; COP1; PSEUDO ICE; CARD only protein; caspase-1 inhibitor COP; CARD only domain-containing protein 1; pseudo interleukin-1beta converting enzyme; pseudo interleukin-1 beta converting enzyme; caspase-1 dominant-negative inhibitor pseudo-ICE; PSEUDO-ICE; |
| Gene ID | 114769 |
| mRNA Refseq | NM_052889 |
| Protein Refseq | NP_443121 |
| MIM | 615680 |
| UniProt ID | Q5EG05 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARD16 Products
Required fields are marked with *
My Review for All CARD16 Products
Required fields are marked with *



