Recombinant Human CARD16 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CARD16-6035H
Product Overview : CARD16 MS Standard C13 and N15-labeled recombinant protein (NP_443121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CARD16 (Caspase Recruitment Domain Family Member 16) is a Protein Coding gene. Diseases associated with CARD16 include Nodular Lymphocyte Predominant Hodgkin Lymphoma and Panhypopituitarism, X-Linked. Among its related pathways are NOD-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CASP1.
Molecular Mass : 10.6 kDa
AA Sequence : MRKAMADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CARD16 caspase recruitment domain family member 16 [ Homo sapiens (human) ]
Official Symbol CARD16
Synonyms CARD16; caspase recruitment domain family, member 16; caspase recruitment domain-containing protein 16; COP; COP1; PSEUDO ICE; CARD only protein; caspase-1 inhibitor COP; CARD only domain-containing protein 1; pseudo interleukin-1beta converting enzyme; pseudo interleukin-1 beta converting enzyme; caspase-1 dominant-negative inhibitor pseudo-ICE; PSEUDO-ICE;
Gene ID 114769
mRNA Refseq NM_052889
Protein Refseq NP_443121
MIM 615680
UniProt ID Q5EG05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CARD16 Products

Required fields are marked with *

My Review for All CARD16 Products

Required fields are marked with *

0
cart-icon