Recombinant Human CARTPT protein, His-tagged
Cat.No. : | CARTPT-1726H |
Product Overview : | Recombinant Human CARTPT protein(27-116 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-116 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | AQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CARTPT CART prepropeptide [ Homo sapiens ] |
Official Symbol | CARTPT |
Synonyms | CARTPT; CART prepropeptide; cocaine- and amphetamine-regulated transcript protein; CART; cocaine and amphetamine regulated transcript; |
Gene ID | 9607 |
mRNA Refseq | NM_004291 |
Protein Refseq | NP_004282 |
MIM | 602606 |
UniProt ID | Q16568 |
◆ Recombinant Proteins | ||
CARTPT-53H | Recombinant Human CARTPT, His-tagged | +Inquiry |
CARTPT-240H | Recombinant Human CARTPT | +Inquiry |
CARTPT-630R | Recombinant Rhesus monkey CARTPT Protein, His-tagged | +Inquiry |
CARTPT-798R | Recombinant Rat CARTPT Protein, His (Fc)-Avi-tagged | +Inquiry |
Cartpt-1968M | Recombinant Mouse Cartpt Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARTPT-911HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
CARTPT-001HCL | Recombinant Human CARTPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARTPT Products
Required fields are marked with *
My Review for All CARTPT Products
Required fields are marked with *
0
Inquiry Basket