Recombinant Human CASC3 Protein, GST-Tagged

Cat.No. : CASC3-0408H
Product Overview : Human CASC3 partial ORF (NP_031385, 604 a.a. - 703 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene is a core component of the exon junction complex (EJC), a protein complex that is deposited on spliced mRNAs at exon-exon junctions and functions in nonsense-mediated mRNA decay (NMD). The encoded protein binds RNA and interacts with two other EJC core components. It is predominantly located in the cytoplasm, but shuttles into the nucleus where it localizes to nuclear speckles. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : VSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CASC3 cancer susceptibility candidate 3 [ Homo sapiens ]
Official Symbol CASC3
Synonyms CASC3; cancer susceptibility candidate 3; protein CASC3; BTZ; MLN51; MLN 51; barentsz; protein barentsz; metastatic lymph node 51; metastatic lymph node gene 51 protein; cancer susceptibility candidate gene 3 protein;
Gene ID 22794
mRNA Refseq NM_007359
Protein Refseq NP_031385
MIM 606504
UniProt ID O15234

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASC3 Products

Required fields are marked with *

My Review for All CASC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon