Recombinant Human CASC3 Protein, GST-Tagged
Cat.No. : | CASC3-0408H |
Product Overview : | Human CASC3 partial ORF (NP_031385, 604 a.a. - 703 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene is a core component of the exon junction complex (EJC), a protein complex that is deposited on spliced mRNAs at exon-exon junctions and functions in nonsense-mediated mRNA decay (NMD). The encoded protein binds RNA and interacts with two other EJC core components. It is predominantly located in the cytoplasm, but shuttles into the nucleus where it localizes to nuclear speckles. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VSMSPGQPPPQQLLAPTYFSAPGVMNFGNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSRGSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASC3 cancer susceptibility candidate 3 [ Homo sapiens ] |
Official Symbol | CASC3 |
Synonyms | CASC3; cancer susceptibility candidate 3; protein CASC3; BTZ; MLN51; MLN 51; barentsz; protein barentsz; metastatic lymph node 51; metastatic lymph node gene 51 protein; cancer susceptibility candidate gene 3 protein; |
Gene ID | 22794 |
mRNA Refseq | NM_007359 |
Protein Refseq | NP_031385 |
MIM | 606504 |
UniProt ID | O15234 |
◆ Recombinant Proteins | ||
CASC3-1141R | Recombinant Rat CASC3 Protein | +Inquiry |
CASC3-505H | Recombinant Human CASC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASC3-0408H | Recombinant Human CASC3 Protein, GST-Tagged | +Inquiry |
Casc3-1969M | Recombinant Mouse Casc3 Protein, Myc/DDK-tagged | +Inquiry |
CASC3-799R | Recombinant Rat CASC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASC3-7844HCL | Recombinant Human CASC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASC3 Products
Required fields are marked with *
My Review for All CASC3 Products
Required fields are marked with *