Recombinant Human CASP14 protein, GST-tagged

• Cat.No.: CASP14-2635H
• Product Overview: Recombinant Human CASP14 protein(P31944)(153-240aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 153-240aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.2 kDa
• AA Sequence: KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CASP14 caspase 14, apoptosis-related cysteine peptidase [ Homo sapiens ]
• Official Symbol: CASP14
• Synonyms: CASP14; caspase 14, apoptosis-related cysteine peptidase; caspase 14, apoptosis related cysteine protease; caspase-14; apoptosis related cysteine protease; MGC119078; MGC119079; MICE; CASP-14; apoptosis-related cysteine protease; caspase 14, apoptosis-related cysteine protease
• Gene ID: 23581
• mRNA Refseq: NM_012114
• Protein Refseq: NP_036246
• MIM: 605848
• UniProt ID: P31944