Recombinant Human CASP14 protein, GST-tagged
Cat.No. : | CASP14-2635H |
Product Overview : | Recombinant Human CASP14 protein(P31944)(153-240aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 153-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CASP14 caspase 14, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP14 |
Synonyms | CASP14; caspase 14, apoptosis-related cysteine peptidase; caspase 14, apoptosis related cysteine protease; caspase-14; apoptosis related cysteine protease; MGC119078; MGC119079; MICE; CASP-14; apoptosis-related cysteine protease; caspase 14, apoptosis-related cysteine protease; |
Gene ID | 23581 |
mRNA Refseq | NM_012114 |
Protein Refseq | NP_036246 |
MIM | 605848 |
UniProt ID | P31944 |
◆ Recombinant Proteins | ||
CASP14-1591H | Recombinant Human CASP14 Protein (Ser2-Gln242), C-His tagged | +Inquiry |
CASP14-3637H | Recombinant Human CASP14 protein, His-tagged | +Inquiry |
CASP14-2635H | Recombinant Human CASP14 protein, GST-tagged | +Inquiry |
CASP14-1168H | Recombinant Human CASP14 Protein, His-tagged | +Inquiry |
CASP14-301644H | Recombinant Human CASP14 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP14-145HCL | Recombinant Human CASP14 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP14 Products
Required fields are marked with *
My Review for All CASP14 Products
Required fields are marked with *