Recombinant Human CASP7 protein, GST-tagged

Cat.No. : CASP7-301351H
Product Overview : Recombinant Human CASP7 (1-100 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Cys100
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name CASP7 caspase 7, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP7
Synonyms CASP7; caspase 7, apoptosis-related cysteine peptidase; caspase 7, apoptosis related cysteine protease; caspase-7; CMH 1; ICE LAP3; MCH3; CASP-7; Lice2 alpha/beta/gamma; caspase 7 isoform delta; apoptotic protease MCH-3; ICE-like apoptotic protease 3; caspase 7, apoptosis-related cysteine protease; CMH-1; ICE-LAP3;
Gene ID 840
mRNA Refseq NM_001227
Protein Refseq NP_001218
MIM 601761
UniProt ID P55210

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASP7 Products

Required fields are marked with *

My Review for All CASP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon