Recombinant Human CASP7 protein, GST-tagged
Cat.No. : | CASP7-301351H |
Product Overview : | Recombinant Human CASP7 (1-100 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Cys100 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CASP7 caspase 7, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP7 |
Synonyms | CASP7; caspase 7, apoptosis-related cysteine peptidase; caspase 7, apoptosis related cysteine protease; caspase-7; CMH 1; ICE LAP3; MCH3; CASP-7; Lice2 alpha/beta/gamma; caspase 7 isoform delta; apoptotic protease MCH-3; ICE-like apoptotic protease 3; caspase 7, apoptosis-related cysteine protease; CMH-1; ICE-LAP3; |
Gene ID | 840 |
mRNA Refseq | NM_001227 |
Protein Refseq | NP_001218 |
MIM | 601761 |
UniProt ID | P55210 |
◆ Recombinant Proteins | ||
CASP7-6396H | Recombinant Human CASP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CASP7-2786Z | Recombinant Zebrafish CASP7 | +Inquiry |
CASP7-7269H | Recombinant Human CASP7 protein(Met1-Gln303), His-tagged | +Inquiry |
CASP7-2755M | Recombinant Mouse CASP7 Protein | +Inquiry |
CASP7-680H | Recombinant Human CASP7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP7-7833HCL | Recombinant Human CASP7 293 Cell Lysate | +Inquiry |
CASP7-7832HCL | Recombinant Human CASP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP7 Products
Required fields are marked with *
My Review for All CASP7 Products
Required fields are marked with *
0
Inquiry Basket