Recombinant Human CASP7 protein, GST-tagged

• Cat.No.: CASP7-301351H
• Product Overview: Recombinant Human CASP7 (1-100 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Cys100
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CASP7 caspase 7, apoptosis-related cysteine peptidase [ Homo sapiens ]
• Official Symbol: CASP7
• Synonyms: CASP7; caspase 7, apoptosis-related cysteine peptidase; caspase 7, apoptosis related cysteine protease; caspase-7; CMH 1; ICE LAP3; MCH3; CASP-7; Lice2 alpha/beta/gamma; caspase 7 isoform delta; apoptotic protease MCH-3; ICE-like apoptotic protease 3; caspase 7, apoptosis-related cysteine protease; CMH-1; ICE-LAP3
• Gene ID: 840
• mRNA Refseq: NM_001227
• Protein Refseq: NP_001218
• MIM: 601761
• UniProt ID: P55210