Recombinant Human CASP8 Protein(217–374aa), His-tagged
Cat.No. : | CASP8-4937H |
Product Overview : | Recombinant Human CASP8 Protein(217–374aa)(Q14790), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 217–374aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.9kDa |
AA Sequence : | SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | CASP8 caspase 8, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP8 |
Synonyms | CASP8; caspase 8, apoptosis-related cysteine peptidase; caspase 8, apoptosis related cysteine protease; caspase-8; Casp 8; FLICE; MACH; MCH5; FADD-like ICE; MACH-alpha-1/2/3 protein; apoptotic protease Mch-5; MACH-beta-1/2/3/4 protein; apoptotic cysteine protease; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog; FADD-homologous ICE/CED-3-like protease; caspase 8, apoptosis-related cysteine protease; CAP4; ALPS2B; Casp-8; FLJ17672; MGC78473; |
Gene ID | 841 |
mRNA Refseq | NM_001080124 |
Protein Refseq | NP_001073593 |
MIM | 601763 |
UniProt ID | Q14790 |
◆ Recombinant Proteins | ||
CASP8-4937H | Recombinant Human CASP8 Protein(217–374aa), His-tagged | +Inquiry |
CASP8-26H | Active Recombinant Human CASP8, His-tagged | +Inquiry |
CASP8-7827C | Recombinant Cattle CASP8 protein, His-tagged | +Inquiry |
CASP8-147H | Recombinant Human CASP8 Protein, His-tagged | +Inquiry |
Casp8-1645M | Recombinant Mouse Caspase 8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP8-7829HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
CASP8-7830HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
CASP8-7831HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP8 Products
Required fields are marked with *
My Review for All CASP8 Products
Required fields are marked with *
0
Inquiry Basket