Recombinant Human CASP8 Protein(217–374aa), His-tagged
| Cat.No. : | CASP8-4937H |
| Product Overview : | Recombinant Human CASP8 Protein(217–374aa)(Q14790), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 217–374aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.9kDa |
| AA Sequence : | SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | CASP8 caspase 8, apoptosis-related cysteine peptidase [ Homo sapiens ] |
| Official Symbol | CASP8 |
| Synonyms | CASP8; caspase 8, apoptosis-related cysteine peptidase; caspase 8, apoptosis related cysteine protease; caspase-8; Casp 8; FLICE; MACH; MCH5; FADD-like ICE; MACH-alpha-1/2/3 protein; apoptotic protease Mch-5; MACH-beta-1/2/3/4 protein; apoptotic cysteine protease; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog; FADD-homologous ICE/CED-3-like protease; caspase 8, apoptosis-related cysteine protease; CAP4; ALPS2B; Casp-8; FLJ17672; MGC78473; |
| Gene ID | 841 |
| mRNA Refseq | NM_001080124 |
| Protein Refseq | NP_001073593 |
| MIM | 601763 |
| UniProt ID | Q14790 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASP8 Products
Required fields are marked with *
My Review for All CASP8 Products
Required fields are marked with *
