Recombinant Human CASP8 Protein(217–374aa), His-tagged

Cat.No. : CASP8-4937H
Product Overview : Recombinant Human CASP8 Protein(217–374aa)(Q14790), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 217–374aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 21.9kDa
AA Sequence : SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name CASP8 caspase 8, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP8
Synonyms CASP8; caspase 8, apoptosis-related cysteine peptidase; caspase 8, apoptosis related cysteine protease; caspase-8; Casp 8; FLICE; MACH; MCH5; FADD-like ICE; MACH-alpha-1/2/3 protein; apoptotic protease Mch-5; MACH-beta-1/2/3/4 protein; apoptotic cysteine protease; ICE-like apoptotic protease 5; MORT1-associated ced-3 homolog; FADD-homologous ICE/CED-3-like protease; caspase 8, apoptosis-related cysteine protease; CAP4; ALPS2B; Casp-8; FLJ17672; MGC78473;
Gene ID 841
mRNA Refseq NM_001080124
Protein Refseq NP_001073593
MIM 601763
UniProt ID Q14790

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASP8 Products

Required fields are marked with *

My Review for All CASP8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon