Recombinant Human CASQ1 protein, His-tagged
| Cat.No. : | CASQ1-3138H |
| Product Overview : | Recombinant Human CASQ1 protein(35-91 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 35-91 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CASQ1 calsequestrin 1 (fast-twitch, skeletal muscle) [ Homo sapiens ] |
| Official Symbol | CASQ1 |
| Synonyms | CASQ1; calsequestrin 1 (fast-twitch, skeletal muscle); CASQ; calsequestrin-1; calmitine; calsequestrin 1; fast twitch; skeletal muscle; PDIB1; calmitin; calsequestrin, skeletal muscle isoform; |
| Gene ID | 844 |
| mRNA Refseq | NM_001231 |
| Protein Refseq | NP_001222 |
| MIM | 114250 |
| UniProt ID | P31415 |
| ◆ Recombinant Proteins | ||
| CASQ1-627H | Recombinant Human CASQ1 Protein, His-tagged | +Inquiry |
| CASQ1-1249M | Recombinant Mouse CASQ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CASQ1-10740H | Recombinant Human CASQ1, His-tagged | +Inquiry |
| CASQ1-805R | Recombinant Rat CASQ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Casq1-774M | Recombinant Mouse Casq1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CASQ1-7827HCL | Recombinant Human CASQ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASQ1 Products
Required fields are marked with *
My Review for All CASQ1 Products
Required fields are marked with *
