Recombinant Human CASQ1 protein, His-tagged
Cat.No. : | CASQ1-3138H |
Product Overview : | Recombinant Human CASQ1 protein(35-91 aa), fused to His tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 35-91 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CASQ1 calsequestrin 1 (fast-twitch, skeletal muscle) [ Homo sapiens ] |
Official Symbol | CASQ1 |
Synonyms | CASQ1; calsequestrin 1 (fast-twitch, skeletal muscle); CASQ; calsequestrin-1; calmitine; calsequestrin 1; fast twitch; skeletal muscle; PDIB1; calmitin; calsequestrin, skeletal muscle isoform; |
Gene ID | 844 |
mRNA Refseq | NM_001231 |
Protein Refseq | NP_001222 |
MIM | 114250 |
UniProt ID | P31415 |
◆ Recombinant Proteins | ||
CASQ1-1708HFL | Recombinant Full Length Human CASQ1 Protein, C-Flag-tagged | +Inquiry |
CASQ1-509H | Recombinant Human CASQ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASQ1-511H | Recombinant Human CASQ1 protein(Gln35-Asp396) | +Inquiry |
Casq1-774M | Recombinant Mouse Casq1 Protein, MYC/DDK-tagged | +Inquiry |
CASQ1-185H | Recombinant Human calsequestrin 1 Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASQ1-7827HCL | Recombinant Human CASQ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASQ1 Products
Required fields are marked with *
My Review for All CASQ1 Products
Required fields are marked with *