Recombinant Human catechol O methyltransferase Protein, His tagged
| Cat.No. : | COMT-001H |
| Product Overview : | Recombinant Human COMT Protein with C-His tag was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 52-271 aa |
| Description : | Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. |
| Tag : | C-His |
| Molecular Mass : | 26 kDa |
| AA Sequence : | MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGPHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | COMT catechol-O-methyltransferase [ Homo sapiens (human) ] |
| Official Symbol | COMT |
| Synonyms | COMT; catechol-O-methyltransferase; catechol O-methyltransferase |
| Gene ID | 1312 |
| mRNA Refseq | NM_000754 |
| Protein Refseq | NP_000745 |
| MIM | 116790 |
| UniProt ID | P21964 |
| ◆ Recombinant Proteins | ||
| Comt-829R | Recombinant Rat Comt Protein, His-tagged | +Inquiry |
| COMT-1688H | Recombinant Human COMT Protein, GST-tagged | +Inquiry |
| COMT-126H | Recombinant Human Catechol-O-methyltransferase, His-tagged | +Inquiry |
| COMT-1253H | Recombinant Human Catechol-O-Methyltransferase | +Inquiry |
| COMT-021H | Recombinant Human COMT Protein, His/SUMOpro-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COMT-7365HCL | Recombinant Human COMT 293 Cell Lysate | +Inquiry |
| COMT-121HKCL | Human COMT Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMT Products
Required fields are marked with *
My Review for All COMT Products
Required fields are marked with *
