"CBFB" Related Products

Expand
Expand
Expand

Recombinant Human CBFB protein, T7/His-tagged

Cat.No.: CBFB-198H
Product Overview: Recombinant human CBFβ (182 aa, derived from BC018509) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNAC RDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMG CLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: CBFB core-binding factor, beta subunit [ Homo sapiens ]
Official Symbol: CBFB
Synonyms: CBFB; core-binding factor, beta subunit; core-binding factor subunit beta; PEBP2B; CBF-beta; PEA2-beta; PEBP2-beta; SL3-3 enhancer factor 1 beta subunit; SL3-3 enhancer factor 1 subunit beta; SL3/AKV core-binding factor beta subunit; polyomavirus enhancer-binding protein 2 beta subunit; polyomavirus enhancer binding protein 2, beta subunit;
Gene ID: 865
mRNA Refseq: NM_001755
Protein Refseq: NP_001746
MIM: 121360
UniProt ID: Q13951
Chromosome Location: 16q22.1
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Regulation of nuclear SMAD2/3 signaling, organism-specific biosystem;
Function: protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.