Recombinant Human CCDC112 protein, His-tagged

Cat.No. : CCDC112-91H
Product Overview : Recombinant Human CCDC112 protein(Q8NEF3)(73-227aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 73-227aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 24.3 kDa
AA Sequence : REMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEEVLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKGKPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQI
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CCDC112 coiled-coil domain containing 112 [ Homo sapiens ]
Official Symbol CCDC112
Synonyms CCDC112; coiled-coil domain containing 112; coiled-coil domain-containing protein 112; MGC39633; mutated in bladder cancer 1; mutated in bladder cancer protein 1; MBC1;
Gene ID 153733
mRNA Refseq NM_001040440
Protein Refseq NP_001035530
UniProt ID Q8NEF3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC112 Products

Required fields are marked with *

My Review for All CCDC112 Products

Required fields are marked with *

0
cart-icon