Recombinant Human CCDC112 protein, His-tagged
Cat.No. : | CCDC112-91H |
Product Overview : | Recombinant Human CCDC112 protein(Q8NEF3)(73-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 73-227aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.3 kDa |
AA Sequence : | REMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEEVLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKGKPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CCDC112 coiled-coil domain containing 112 [ Homo sapiens ] |
Official Symbol | CCDC112 |
Synonyms | CCDC112; coiled-coil domain containing 112; coiled-coil domain-containing protein 112; MGC39633; mutated in bladder cancer 1; mutated in bladder cancer protein 1; MBC1; |
Gene ID | 153733 |
mRNA Refseq | NM_001040440 |
Protein Refseq | NP_001035530 |
UniProt ID | Q8NEF3 |
◆ Recombinant Proteins | ||
CCDC112-91H | Recombinant Human CCDC112 protein, His-tagged | +Inquiry |
CCDC112-0512H | Recombinant Human CCDC112 Protein, GST-Tagged | +Inquiry |
CCDC112-016H | Recombinant Human DENND2B protein, HIS-tagged | +Inquiry |
CCDC112-92H | Recombinant Human CCDC112 protein, His-SUMO-tagged | +Inquiry |
CCDC112-90H | Recombinant Human CCDC112 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC112-7788HCL | Recombinant Human CCDC112 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC112 Products
Required fields are marked with *
My Review for All CCDC112 Products
Required fields are marked with *